TTHERM_01082940

Length: 441 bp

protein Sequence

MQGEINRDEIEESKENQSNSYSQNYQQYEKLKSSQVQQDENDQNQYVQNNQQYEIQQNQNDQNNQNNPLYDQPFKFEVNHNIDNDLQMIKDWIGQFSNLKDVQQQNEASHDFMQNFVTQYPTSDLSLPDISFHFKPDGSQAILFSIFCQPEILQKCVAKRNDIAELFYDSIGFTILLVIKPKIDYKNFDQKHQEFNSNEIPLEVFISNKFESQQKILYKIGLQAKRQIKVFPQIQNLRLRRDLNELFECLDDKFEFNYSNCSDHCFAYYTQSDNLNQLEGLIIGPQDTPYEGIPYTVTIQIPDQYPIEPPKVTFNQQILHPNISEQGEICLNILQDKWSTVLTIQKVLVSIVSLLYEKNLDDVYNHYAKTLYQEDPEEYKTLIKKQSILQDSQKLKIDFKQLAKVPINEQNGYDEYENNDGYNTYEGYDDDDYQYMDIEDE*