TTHERM_01093500

Length: 142 bp

protein Sequence

MEGEGLNAKALNDALMKEDEWAKAIIFDQNLNIITHKNCPASVEELRPYLTAFDSRDNTIGAGFELLGEHYDVHRFHPPLVYGRRGDADVGEGISLAKGFSKKANSNIYLLITYELPIISARAVPQQINFFNNHIGELEQAQ*