TTHERM_01099200

Length: 225 bp

protein Sequence

MERADRRYKFEHNWAKGFCYFTFGEYYNPRKMGVGRIKAVNEYQLNPQEEFGKNILHKNFDIVTLVMNGSLRHNSSVKERVPIERGQCHLLRTGPNEIKHGIQNVDQNIQGEIFEFWIQNDQVFQKEEGEQATYQFDVVRKQLNTLQTVIQNDNIELSICHLDKNNTITIQNESLKNIFILNLNGPAIINETVKLNDRDAFTEVCASYNLKSTESCITLLILKAI*