TTHERM_01123950

Length: 151 bp

protein Sequence

MAGPTPRIMKETQKLQTEQVPGIDVVPNKDNFRHFYVKIQGPDNTPYAGGIFTAELLLPEQYPMNPPKVIFCTKIYHPNIDNLGRICLDILKDKWSPALQIRSVLLSIQALLSSPNPDDPLNNEAAEQWKNDEQNALKKAKEYTQKYATGK*