TTHERM_01142760

Length: 110 bp

protein Sequence

IRLKDISKFNLIASKIKNIKMSSGDLPSATLSMIQQGQDPKELVLQHCKPNCLHWEQKLKRCEAKLRELVNADPEMSCMYPLRDWVTCVEACVQPQIISQLVGAQKGRIW*