TTHERM_01184160

Length: 217 bp

protein Sequence

MNSNNNYQQLNSEPNQFSQGQNTPTIQAQPQQPQLISQLPDFSNYPPPSYDNFNNQMPQQKYSPPPPPPLQSYAPNQAQNYQALPSQNCYQPPLTTNYPSPAQNYYPPPPQNGPYHIPYQTNQLQPQQYTPMYQNQVMLQNGDNLNPYQFCPQCNQVRPTIKSGQAGTGAVICACLLCIFCGVFGLFACCCEQCQDKEYSCYVCRTVLKIEPYQPCG*