TTHERM_01205250

Length: 186 bp

protein Sequence

KINQIKIRIYFRFNSERKYKMINISKSASKVLKLNQALNAQFSRVRSFNDFKAAKTYIDTLKPKLACLYFRADWNPLCEQADKDFDKLSDTHLEYEFVKIDIDKAPQAKGYFAVRCEPEFLLLCLGQEMTRQTGQNQRNLEHRLFKVQEYVKGLNFPAGMDTYEEFHEQYMAEHTQLDKEINEWAR*