TTHERM_01217200

Length: 372 bp

protein Sequence

MNQPQQQQQDASLQDIQINNPQHLPQDTVSDIQFNPQNPQMFACSTWDGKIHIYQIAVQQNFNQIVGQFQQVSQMQYNEPITCIAWRGDGQAIYAGCGDNSVVLFNLSNGQSAKIGQHQAGIRSIFYVQQLNGAVITCSFDTTVCFWSEQNPNNPLAKIQLKGKIFAADCLFPILALGLQGEVITFINLQSNFQNLSPHQINYIDSPLGKGSQINSIKIMCKGNGFGLGSIDGRANLGKLTPQNQNNVAGYKIDNIMTFKCHKNEEKQNNVVNQILYPVNSICFNPRQDQFLLTCGSDGNMYFWDFEHKNKIKSFAFNKQPISACNVSSTGQFLAYSLGYDWHMGYEHSNSFEKPKICVHIINDDELRFRKN*