TTHERM_01289060

Length: 68 bp

protein Sequence

MEQNTTQVFSDLAYKVCFKVINDKNKPFVLHDEQRLANCLTRYVEAFNVTSEYFFRERAGETKVTEKQ*