TTHERM_01289140

Length: 202 bp

protein Sequence

MNNSEVAVLGGGCFWCIYAVFKRVKGVQKVISGFSGGELKNPTYKEVYTGTTGHAEVVQVTFDPEVISYENLLRIYFNVHDPTLLNRQNDEDVGTHYRSVIFYLSEQQQKTALALIKELEESKYYKDPIVTKVDKFEEFYPAEDYHQNYFDINPEQRYCKAVVEPKLKKFLIKYKDYLKQEEEELKQKQLQQEQQQQQQSQQ*