TTHERM_01308050

Length: 487 bp

protein Sequence

MLSKSLKTVSSLLVPRYSFSANFRTEHDTFGEIKVPAQKLWGAQTQRSIQNFEICQDVDKMPKSVIRAFGILKKSAAKVNQRYALDVKKASAIMEAADEVIKGKWDDQFPLVIWQTGSGTQSNMNANEVIANRAMEILGQPFSKAVHPNDHVNMSQSSNDTFPSVMHIAAVMEVHHTLLPGLRALLKALEDKQEEFKHIIKIGRTHTQDATPLTLGQEFSGYVTQIRNAIHRIESKLPEISELAQGGTAVGTGLNTYTGFAEAIAEEVSRETGFKFTTAPNKFEALQCNDALVEFSGALNTTACALMKIANDIRFLGSGPRSGLGELLLPENEPGSSIMPGKVNPTQCESLTMCCAQVMGNHVAISVGGSNGHFELNVFRPMIIRNIIHSVRLLGEGSLSFTKNCVVGIKADTKRIDHLMQQSLMLVTALNPYIGYEKAAKIAKNAHKKNLTLLQSGLELGYLTEEQFKQWVKPEQMLGPSEYVKKN*