TTHERM_01467280

Length: 305 bp

protein Sequence

MIRQFRIFLNQAKNSTSFKQRFNFSNMVNPYSALNHTLLKNIYIFKQEEGYCGYIIKDDETNSLVCVDPGRFDVAVEHVKIMESQLKCKLTHVLCTHNFHMNKDTHKFLTYNDGVKIVAGNQGENITFHNQIAYDIKPFNIGELAVCYLYTPGHSSDSFTIAITQCNENSTKLPIIFTGETLLISSIGDIQPNGHKQMLETIFKLKSFPNETLLFPSKDGQLEDLLFAKSLDPGNPVINLKIQLAKQAIEKKTHILPSSLLEEKNCNPYLRLHDNQILKNANARNPTDALKNLKSLQNTFYNSSK*