TTHERM_02031490

Length: 103 bp

protein Sequence

MPQIAKFKKIFSIQSIELQLTAFLRMGAGFKTSEESMIELKLCLKKQILEVLDYPNYEYKLGLEDQYKQKLSQFDDLKFYLAIFYQGSKYILMDVNIVNEFIN*